Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Von Hippel Lindau/VHL Rabbit mAb |
---|---|
Catalog No. | A23239 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC59984 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Von Hippel Lindau/VHL. (NP_000542.1). |
---|---|
Sequence | TLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER |
Gene ID | |
Swiss Prot | |
Synonyms | RCA1; VHL1; pVHL; HRCA1; Von Hippel Lindau/VHL |
Calculated MW | 24kDa |
Observed MW | 18-24kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, Mouse brain, Mouse kidney, Rat brain, Rat kidney |
Cellular location | Cytoplasm, Membrane, Nucleus, Nucleus, Peripheral membrane protein. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23239? Please let us know so that we can cite the reference in this datasheet.