제품 > 항체 > 단일클론항체(mAb)

[KD Validated] βIII-Tubulin Mouse mAb (A18132)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type(WT) and βIII-Tubulin knockdown (KD) HeLa cells, using [KD Validated] βIII-Tubulin Mouse mAb (A18132) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KD Validated] βIII-Tubulin Mouse mAb (A18132)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] βIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] βIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KD Validated] βIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using [KD Validated] βIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] βIII-Tubulin Mouse mAb (A18132)

Immunofluorescence analysis of paraffin-embedded mouse brain using [KO Validated] βIII-Tubulin Mouse mAb (A18132) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	[KD Validated] βIII-Tubulin Mouse mAb
Catalog No.	A18132
Host species	Mouse
Purification method	Affinity purification
Isotype	IgG2b, kappa
CloneNo.	AMC0115

Background

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human TUBB3 (Q13509).
Sequence	SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Gene ID
Swiss Prot
Synonyms	CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; [KD Validated] βIII-Tubulin
Calculated MW	50kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:1000 - 1:10000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	Cytoplasm, cytoskeleton.
Customer validation	IF(Mus musculus ) WB(Rattus norvegicus, Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] βIII-Tubulin Mouse mAb images

Western blot - [KD Validated] βIII-Tubulin Mouse mAb (A18132)

Immunohistochemistry - [KD Validated] βIII-Tubulin Mouse mAb (A18132)

Immunofluorescence - [KD Validated] βIII-Tubulin Mouse mAb (A18132)

Immunofluorescence analysis of paraffin-embedded mouse brain using [KO Validated] βIII-Tubulin Mouse mAb (A18132) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.