제품 > 항체 > 단일클론항체(mAb)

[KO Validated] βIII-Tubulin Rabbit mAb (A24067)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from wild type (WT) and βIII-Tubulin knockout (KO) HeLa cells using [KO Validated] βIII-Tubulin Rabbit mAb(A24067) at 1:3000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:20s.

ABclonal:Immunohistochemistry - [KO Validated] βIII-Tubulin Rabbit mAb (A24067)

Immunohistochemistry analysis of βIII-Tubulin in paraffin-embedded human endometrium cancer tissue using [KO Validated] βIII-Tubulin Rabbit mAb (A24067) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit mAb (A24067)

Confocal imaging of paraffin-embedded mouse brain using [KO Validated] βIII-Tubulin Rabbit mAb (A24067, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - [KO Validated] βIII-Tubulin Rabbit mAb (A24067)

Immunoprecipitation of βIII-Tubulin in 300 µg extracts from HeLa cells using 3 µg [KO Validated] βIII-Tubulin Rabbit mAb (A24067). Western blot analysis was performed using [KO Validated] βIII-Tubulin Rabbit mAb (A24067) at 1:3000 dilution.

Overview

Product name	[KO Validated] βIII-Tubulin Rabbit mAb
Catalog No.	A24067
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63789

Background

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 351-450 of βIII-Tubulin (NP_006077.2).
Sequence	VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Gene ID
Swiss Prot
Synonyms	CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; in
Calculated MW	50kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:20000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa
Cellular location	Cytoplasm, cytoskeleton