Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | βIII-Tubulin Rabbit mAb |
---|---|
Catalog No. | A17913 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0456 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin (Q13509). |
---|---|
Sequence | VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK |
Gene ID | |
Swiss Prot | |
Synonyms | CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; βIII-Tubulin |
Calculated MW | 50kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain |
Cellular location | Cytoplasm, cytoskeleton. |
Customer validation | IF(Rattus norvegicus, Homo sapiens, Chlorocebus aethiops) WB(Homo sapiens, Rattus norvegicus, Mus musculus) Other(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17913? Please let us know so that we can cite the reference in this datasheet.