제품 > 항체 > 다중클론항체(pAb)

MAPK1/MAPK3 Rabbit pAb (A16736)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MAPK1/MAPK3 Rabbit pAb (A16736) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - MAPK1/MAPK3 Rabbit pAb (A16736)

Immunofluorescence analysis of NIH-3T3 cells using MAPK1/MAPK3 Rabbit pAb (A16736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of Hela cells using MAPK1/MAPK3 Rabbit pAb (A16736) at dilution of 1:200. Blue: DAPI for nuclear staining.

Overview

Product name	MAPK1/MAPK3 Rabbit pAb
Catalog No.	A16736
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MAPK1/MAPK3 (NP_620407.1/NP_002737.2).
Sequence	LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Gene ID
Swiss Prot
Synonyms
Calculated MW	36kDa/38kDa/40kDa/41kDa/43kDa
Observed MW	41kDa/43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, 293T, NIH/3T3, Mouse kidney, Mouse brain, Rat brain
Cellular location	caveola, cytoplasm, cytoskeleton, cytosol, early endosome, endoplasmic reticulum lumen, extracellular region, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, mitotic spindle, nucleoplasm, nucleus, plasma membrane