제품 > 항체 > 다중클론항체(pAb)

MAPK1/MAPK3 Rabbit pAb (A17291)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MAPK1/MAPK3 Rabbit pAb (A17291) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MAPK1/MAPK3 Rabbit pAb (A17291)

Immunohistochemistry analysis of paraffin-embedded human urothelial carcinoma using MAPK1/MAPK3 Rabbit pAb (A17291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse heart using MAPK1/MAPK3 Rabbit pAb (A17291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat lung using MAPK1/MAPK3 Rabbit pAb (A17291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	MAPK1/MAPK3 Rabbit pAb
Catalog No.	A17291
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MAPK1/MAPK3ERK1/2 (P27361/P28482).
Sequence	FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD/LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Gene ID
Swiss Prot
Synonyms	MAPK1/MAPK3
Calculated MW	36kDa/41kDa/38kDa/40kDa/43kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, NIH/3T3
Cellular location	caveola, cytoplasm, cytoskeleton, cytosol, early endosome, endoplasmic reticulum lumen, extracellular region, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, mitotic spindle, nucleoplasm, nucleus, plasma membrane
Customer validation	IF(Mus musculus)