Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Osteopontin Rabbit pAb |
---|---|
Catalog No. | A1499 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human Osteopontin (NP_001035147.1). |
---|---|
Sequence | NDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI |
Gene ID | |
Swiss Prot | |
Synonyms | OPN; BNSP; BSPI; ETA-1; Osteopontin |
Calculated MW | 35kDa |
Observed MW |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat kidney |
Cellular location | Secreted. |
Customer validation | IHC(Homo sapiens, Rattus norvegicus, Mus musculus) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) ELISA(Homo sapiens, Mus musculus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1499? Please let us know so that we can cite the reference in this datasheet.