Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TSG101/VPS23 Rabbit pAb |
---|---|
Catalog No. | A2216 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1). |
---|---|
Sequence | LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Gene ID | |
Swiss Prot | |
Synonyms | TSG10; VPS23 |
Calculated MW | 44kDa |
Observed MW | 44kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | SH-SY5Y, K-562 |
Cellular location | Cytoplasm, Late endosome membrane, Membrane, Nucleus, Peripheral membrane protein |
Customer validation | WB(Homo sapiens, Danio rerio, Mus musculus, Mus musculus, Rattus norvegicus) IHC(Homo sapiens,Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2216? Please let us know so that we can cite the reference in this datasheet.