Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | TSG101/VPS23 Rabbit mAb |
---|---|
Catalog No. | A5789 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0853 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TSG101/VPS23 (Q99816). |
---|---|
Sequence | MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG |
Gene ID | |
Swiss Prot | |
Synonyms | TSG10; VPS23 |
Calculated MW | 44kDa |
Observed MW | 46kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | PC-12 |
Cellular location | Cytoplasm, Late endosome membrane, Membrane, Nucleus, Peripheral membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens, Bos taurus, Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5789? Please let us know so that we can cite the reference in this datasheet.