제품 > 항체 > 단일클론항체(mAb)

AAMP Rabbit mAb (A20970)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using AAMP Rabbit mAb (A20970) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.

ABclonal:Immunofluorescence - AAMP Rabbit mAb (A20970)

Immunofluorescence analysis of MCF7 cells using AAMP Rabbit mAb (A20970) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	AAMP Rabbit mAb
Catalog No.	A20970
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2959

Background

The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685).
Sequence	MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLD
Gene ID
Swiss Prot
Synonyms	AAMP
Calculated MW	47kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, MCF7, A375, Mouse liver, Mouse testis, Rat liver, Rat testis
Cellular location	Cell membrane, Cytoplasm.
Customer validation	Co-IP(Homo sapiens) WB(Homo sapiens)