Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ABCG1 Rabbit mAb |
---|---|
Catalog No. | A17907 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0336 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3). |
---|---|
Sequence | LLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI |
Gene ID | |
Swiss Prot | |
Synonyms | ABC8; WHITE1; ABCG1 |
Calculated MW | 76kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Hep G2, A-549, HeLa, Mouse liver, Mouse thymus, Rat spleen |
Cellular location | Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17907? Please let us know so that we can cite the reference in this datasheet.