ABflo® 450 Rabbit anti-Mouse CD8a mAb (A25943)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

ABclonal:Flow CytoMetry - ABflo® 450 Rabbit anti-Mouse CD8a mAb (A25943)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Mouse CD8a mAb (A25943, 5 μl/Test, right).

Overview

Product name	ABflo® 450 Rabbit anti-Mouse CD8a mAb
Catalog No.	A25943
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60677-ABflo450

Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8a (NP_001074579.1).
Sequence	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
Gene ID
Swiss Prot
Synonyms	Ly-2; Ly-B; Ly-35; Lyt-2
Calculated MW	27kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein