제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human FATP1 mAb (A25570)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 NTERA-2 cells (Low Expression, left) and SK-MEL-28 cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human FATP1 mAb (A25570, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 SK-MEL-28 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human FATP1 mAb (A25570, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human FATP1 mAb
Catalog No.	A25570
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66918-ABflo488

Background

Enables biotin transmembrane transporter activity; efflux transmembrane transporter activity; and long-chain fatty acid transporter activity. Involved in several processes, including carboxylic acid transmembrane transport; glycerophospholipid biosynthetic process; and lipid transport across blood-brain barrier. Located in membrane. Part of plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 510-646 of human FATP1 (NP_940982.1).
Sequence	DTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
Gene ID
Swiss Prot
Synonyms	FATP; FATP1; ACSVL5; FATP-1
Calculated MW	52kDa/71kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, cytoplasm, endomembrane system, single-pass membrane protein
Customer validation	IF(Sus scrofa)