제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Monkey

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb
Catalog No.	A27104
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71295-ABflo488

Background

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 98-325 of monkey IgG2 (QJB76126.1).
Sequence	glpcrstcppcpaellggpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvevhnaqtkpreeqfnstyrvvsvltvthqdwlngkeytckvsnkalpa
Gene ID
Swiss Prot
Synonyms
Calculated MW
Observed MW

Applications

Reactivity	Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location