제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Monkey

ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, right).

Overview

Product nameABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb
Catalog No.A27104
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC71295-ABflo488
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 98-325 of monkey IgG2 (QJB76126.1).
Sequenceglpcrstcppcpaellggpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvevhnaqtkpreeqfnstyrvvsvltvthqdwlngkeytckvsnkalpa
Gene ID
Swiss Prot
Synonyms
Calculated MW
Observed MW
ReactivityMonkey
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • FC 5 μl per 10^6 cells in 100 μl volume
Storage bufferStore at 2-8℃. Avoid freeze.
Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key applicationFlow Cytometry    
Positive samples
Cellular location

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)}

    Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

    Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
    ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)}

    Flow CytoMetry - ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104)

    Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Monkey IgG2 (Fc) mAb (A27104, 5 μl/Test, right).

    * For research use only. Not for therapeutic or diagnostic purposes.

    ELISA 키트 (5)

    재조합 단백질 (1)

    항체 (2)

    제품 (1)

    Secondary Antibodies (25)