제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD267/TACI mAb (A24918)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and A20 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD267/TACI mAb (A24918, 5 μl/test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A20 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/test, left) or ABflo® 488 Rabbit anti-Mouse CD267/TACI mAb (A24918, 5 μl/test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD267/TACI mAb
Catalog No.	A24918
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62807-ABflo488

Background

Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1).
Sequence	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
Gene ID
Swiss Prot
Synonyms	Taci; 1200009E08Rik
Calculated MW	27kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type III membrane protein