제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse IL-13 mAb (A25118)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) cells were intracellularly-stained with ABflo® 488 Rabbit anti-Mouse IL-13 mAb (A25118, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 CHO (Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse IL-13 mAb (A25118, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse IL-13 mAb
Catalog No.	A25118
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64322-ABflo488

Background

Predicted to enable interleukin-13 receptor binding activity. Involved in positive regulation of cold-induced thermogenesis and positive regulation of macrophage activation. Acts upstream of or within cellular response to cytokine stimulus; inflammatory response; and positive regulation of immune effector process. Located in cytoplasm; external side of plasma membrane; and extracellular space. Is expressed in gut; liver; male reproductive gland or organ; and thymus. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); diffuse scleroderma; lung disease (multiple); and nose disease (multiple). Orthologous to human IL13 (interleukin 13).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-131 of mouse IL-13 (NP_032381.1).
Sequence	PGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Gene ID
Swiss Prot
Synonyms	Il-13
Calculated MW	14kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted