제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Rat CD31 mAb (A25152)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Flow cytometry: 1X10^6 PC-12 cells (negative control, left) and Rat Splenocytes (right) were surface-stained with ABflo® 488 Rabbit anti-Rat CD31 mAb (A25152, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Rat CD31 mAb (A25152, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Rat CD31 mAb
Catalog No.	A25152
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64727-ABflo488

Background

Enables protein phosphatase binding activity. Involved in several processes, including cellular response to interferon-gamma; negative regulation of GTPase activity; and negative regulation of actin filament polymerization. Located in cell surface and ruffle. Used to study pulmonary hypertension. Biomarker of bacterial pneumonia; orchitis; and osteoarthritis. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-585 of rat CD31 (NP_113779.1).
Sequence	QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLA
Gene ID
Swiss Prot
Synonyms	CD31; Pecam; CD31/PECAM1
Calculated MW	76kDa
Observed MW

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell surface, cytoplasm, external side of plasma membrane, extracellular space, plasma membrane
Customer validation	IF(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Rat CD31 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Rat CD31 mAb (A25152)

Flow cytometry: 1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Rat CD31 mAb (A25152, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.