제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD244/2B4 mAb (A24270)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and HEL cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD244/2B4 mAb(A24270, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD244/2B4 mAb(A24270, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD244/2B4 mAb
Catalog No.	A24270
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61963-ABflo594

Background

This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 22-221of human CD244/2B4 (NP_001160135.1).
Sequence	CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA
Gene ID
Swiss Prot
Synonyms	CD244; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; CD244 molecule
Calculated MW	30kDa/36kDa/41kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Human CD244/2B4 mAb images

Flow CytoMetry - ABflo® 594 Rabbit anti-Human CD244/2B4 mAb (A24270)

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD244/2B4 mAb(A24270, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.