제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD300a mAb (A25743)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and RPMI 8226 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD300a mAb (A25743, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RPMI 8226 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left)) or ABflo® 594 Rabbit anti-Human CD300a mAb (A25743, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD300a mAb
Catalog No.	A25743
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67454-ABflo594

Background

This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-178 of human CD300a (NP_009192.2).
Sequence	LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
Gene ID
Swiss Prot
Synonyms	IRC1; IRC2; CLM-8; IRp60; IGSF12; CMRF35H; CMRF-35H; CMRF35-H; CMRF35H9; CMRF35-H9; IRC1/IRC2; CMRF-35-H9
Calculated MW	33kDa/20kDa/12kDa/16.5kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein