제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD62L/L-Selectin mAb (A24632)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 T-47D cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD62L mAb (A24632, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD62L mAb (A24632, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 594 Rabbit anti-Human CD62L/L-Selectin mAb
Catalog No.	A24632
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60035-ABflo594

Background

This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-332 of human CD62L/L-Selectin (NP_000646.3).
Sequence	WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Gene ID
Swiss Prot
Synonyms	SELL; CD62L; LAM1; LECAM1; LEU8; LNHR; LSEL; LYAM1; PLNHR; TQ1; L-selectin
Calculated MW	42kDa/43kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	(Human PBMCs)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Human CD62L/L-Selectin mAb images

Flow CytoMetry - ABflo® 594 Rabbit anti-Human CD62L/L-Selectin mAb (A24632)

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD62L mAb (A24632, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.