제품 > 항체 > 단일클론항체(mAb)

ABflo® 610 Rabbit anti-Human CD94 mAb (A26683)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells (negative control, left) and NK-92MI cells (right) were surface-stained with ABflo® 610 Rabbit anti-Human CD94 mAb (A26683, 5 μl/Test, orange line) or ABflo® 610 Rabbit IgG isotype control (A25826, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 NK-92MI cells were surface-stained with ABflo® 610 Rabbit IgG isotype control (A25826, 5 μl/Test, left) or ABflo® 610 Rabbit anti-Human CD94 mAb (A26683, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 610 Rabbit anti-Human CD94 mAb (A26683, 5 μl/Test, orange line) or ABflo® 610 Rabbit IgG isotype control (A25826, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).Cells in the Lymphocytes gate were used for analysis.

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 610 Rabbit IgG isotype control (A25826, 5 μl/Test, left) or ABflo® 610 Rabbit anti-Human CD94 mAb (A26683, 5 μl/Test, right).Cells in the Lymphocytes gate were used for analysis.

Overview

Product name	ABflo® 610 Rabbit anti-Human CD94 mAb
Catalog No.	A26683
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60983-ABflo610

Background

Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 32-179 of human CD94. (NP_002253.2).
Sequence	KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Gene ID
Swiss Prot
Synonyms	CD94
Calculated MW	21kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type II membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

ABflo® 610 Rabbit anti-Human CD94 mAb images

Flow CytoMetry - ABflo® 610 Rabbit anti-Human CD94 mAb (A26683)

Flow cytometry: 1X10^6 NK-92MI cells were surface-stained with ABflo® 610 Rabbit IgG isotype control (A25826, 5 μl/Test, left) or ABflo® 610 Rabbit anti-Human CD94 mAb (A26683, 5 μl/Test, right).

Flow CytoMetry - ABflo® 610 Rabbit anti-Human CD94 mAb (A26683)

* For research use only. Not for therapeutic or diagnostic purposes.