Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Dog
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD19 mAb (A27218, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Dog CD19 mAb (A27218, 5 μl/Test, right).
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD19 mAb (A27218, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
| Product name | ABflo® 647 Rabbit anti-Dog CD19 mAb |
|---|---|
| Catalog No. | A27218 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC58534-ABflo647 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-299 of dog CD19 (XP_013969991.1). |
|---|---|
| Sequence | PQETLQVEAKEGGKAELPCLKVPSDGPLEQQAWFQGAQSELGLWSQGLGVRKGSLGIQLFVFNVSDQMGGFYLCQPGPPSEQAWQSGWTVSVEGSGELFRWNASALNDSGCGLGNRPSEGPKPSSRYPTSSQLYVWEKDHPEIWETDPECALPRGTLNQSLNQALALPAPDLIVAPGSTFWLPCEVPPAFVARGPISWTHVRPKKHNISLLSLDLREDAPGREMWVLGTLSGGAVLLLPQATVRDAGTYRCYHGNRTVEMQLKVIAQSVRYWLLETGGWK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD19 |
| Calculated MW | |
| Observed MW |
| Reactivity | Dog |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | External side of plasma membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
