제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Dog

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, right).

Overview

Product nameABflo® 647 Rabbit anti-Dog CD4 mAb
Catalog No.A22688
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC56427-ABflo647
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 26-400 of dog CD4 (NP_001003252.1).
Sequence REVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWP
Gene ID
Swiss Prot
SynonymsEukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis
Calculated MW
Observed MW
ReactivityDog
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • FC 5 μl per 10^6 cells in 100 μl volume
Storage bufferStore at 2-8℃. Avoid freeze.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key applicationFlow Cytometry    
Positive samples
Cellular locationCell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)}

    Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)

    Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
    ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)}

    Flow CytoMetry - ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)

    Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, right).

    * For research use only. Not for therapeutic or diagnostic purposes.

    Your recently viewed items