제품 > 항체 > 단일클론항체(mAb)

ACADS / SCAD Rabbit mAb (A20926)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ACADS / SCAD Rabbit mAb (A20926) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - ACADS / SCAD Rabbit mAb (A20926)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	ACADS / SCAD Rabbit mAb
Catalog No.	A20926
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2901

Background

This gene encodes a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with short-chain acyl-CoA dehydrogenase (SCAD) deficiency. Alternative splicing results in two variants which encode different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219).
Sequence	KLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
Gene ID
Swiss Prot
Synonyms	SCAD; ACAD3; ACADS / SCAD
Calculated MW	44kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Jurkat, Mouse liver, Mouse skeletal muscle, Mouse heart, Rat liver, Rat skeletal muscle, Rat heart
Cellular location	Mitochondrion matrix.
Customer validation	WB(Mus musculus)