제품 > 항체 > 다중클론항체(pAb)

AICDA Rabbit pAb (A16217)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from Rat spleen, using AICDA Rabbit pAb (A16217) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Review

Overview

Product name	AICDA Rabbit pAb
Catalog No.	A16217
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cytidine deaminase activity. Involved in cytidine deamination and isotype switching. Acts upstream of or within cellular response to lipopolysaccharide and defense response to bacterium. Predicted to be part of protein-containing complex. Predicted to be active in P-body and nucleus. Is expressed in several structures, including immune system; lower urogenital tract; lung; reproductive system; and urethra epithelium. Human ortholog(s) of this gene implicated in hyperimmunoglobulin syndrome and immunodeficiency with hyper-IgM type 2. Orthologous to human AICDA (activation induced cytidine deaminase).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse AICDA (Q9WVE0).
Sequence	MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRW
Gene ID
Swiss Prot
Synonyms	Aid; Arp2; AICDA
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat spleen
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus, Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus)