Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates using AIF1/IBA1 Rabbit pAb (A1527) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using AIF1/IBA1 Rabbit pAb (A1527) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | AIF1/IBA1 Rabbit pAb |
|---|---|
| Catalog No. | A1527 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3). |
|---|---|
| Sequence | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | IBA1; IRT1; AIF-1; IRT-1; AIF1/IBA1 |
| Calculated MW | 17kDa |
| Observed MW | 17kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | THP-1 |
| Cellular location | Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, ruffle membrane. |
| Customer validation | IHC(Rattus norvegicus, Canis familiaris) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) ELISA(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1527? Please let us know so that we can cite the reference in this datasheet.
