Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | AIF1/IBA1 Rabbit pAb |
---|---|
Catalog No. | A1527 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3). |
---|---|
Sequence | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
Gene ID | |
Swiss Prot | |
Synonyms | IBA1; IRT1; AIF-1; IRT-1; AIF1/IBA1 |
Calculated MW | 17kDa |
Observed MW | 17kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | THP-1 |
Cellular location | Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, ruffle membrane. |
Customer validation | IHC(Rattus norvegicus, Canis familiaris) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) ELISA(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1527? Please let us know so that we can cite the reference in this datasheet.