제품 > 항체 > 단일클론항체(mAb)

ALDOA Rabbit mAb (A11445)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ALDOA Rabbit mAb (A11445) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - ALDOA Rabbit mAb (A11445)

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ALDOA Rabbit mAb (A11445) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using ALDOA Rabbit mAb (A11445) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using ALDOA Rabbit mAb (A11445) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Review

Overview

Product name	ALDOA Rabbit mAb
Catalog No.	A11445
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0598

Background

This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1, 6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075).
Sequence	MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS
Gene ID
Swiss Prot
Synonyms	ALDA; GSD12; HEL-S-87p; ALDOA
Calculated MW	39kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, Jurkat, Mouse brain, Mouse kidney, Rat brain
Cellular location	Cytoplasm, I band, M line, myofibril, sarcomere.
Customer validation	(Pancreatic cancer cells) WB(Mus musculus) IHC(Homo sapiens)