Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | AMPKα2 Rabbit pAb |
---|---|
Catalog No. | A14052 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 270-343 of human AMPKα2 (NP_006243.2). |
---|---|
Sequence | QDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA |
Gene ID | |
Swiss Prot | |
Synonyms | AMPK; AMPK2; PRKAA; AMPKa2 |
Calculated MW | 62kDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, 293T, Mouse brain, Mouse heart, Rat skeletal muscle, Rat liver |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Capra hircus) mIHC(Capra hircus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14052? Please let us know so that we can cite the reference in this datasheet.