제품 > 항체 > 다중클론항체(pAb)

ARHGAP11B Rabbit pAb (A16587)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using ARHGAP11B Rabbit pAb (A16587) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2s.

Overview

Product name	ARHGAP11B Rabbit pAb
Catalog No.	A16587
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable GTPase activator activity. Involved in cerebral cortex development and negative regulation of mitochondrial membrane permeability. Acts upstream of with a positive effect on glutamine catabolic process. Located in mitochondrial matrix.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1).
Sequence	EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
Gene ID
Swiss Prot
Synonyms	B'-T; FAM7B1; GAP (1-8); ARHGAP11B
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y, U-251MG
Cellular location	cytosol, mitochondrial matrix.