Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ASCL4 Rabbit pAb |
---|---|
Catalog No. | A14439 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3). |
---|---|
Sequence | METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE |
Gene ID | |
Swiss Prot | |
Synonyms | ASH-4; HASH4; bHLHa44; ASCL4 |
Calculated MW | 19kDa |
Observed MW | 19kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain, Mouse kidney, Rat liver |
Cellular location | Nucleus. |
Customer validation | WB(Mus musculus, Rattus norvegicus) IHC(Rattus norvegicus) IF(Rattus norvegicus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14439? Please let us know so that we can cite the reference in this datasheet.