제품 > 항체 > 다중클론항체(pAb)

ASCL4 Rabbit pAb (A14439)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ASCL4 Rabbit pAb (A14439) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ASCL4 Rabbit pAb (A14439)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using ASCL4 Rabbit pAb (A14439) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human appendix using ASCL4 Rabbit pAb (A14439) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using ASCL4 Rabbit pAb (A14439) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	ASCL4 Rabbit pAb
Catalog No.	A14439
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3).
Sequence	METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE
Gene ID
Swiss Prot
Synonyms	ASH-4; HASH4; bHLHa44; ASCL4
Calculated MW	19kDa
Observed MW	19kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Mouse kidney, Rat liver
Cellular location	Nucleus.
Customer validation	WB(Mus musculus, Rattus norvegicus) IHC(Rattus norvegicus) IF(Rattus norvegicus) IHC(Mus musculus)