Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | AT1R/AGTR1 Rabbit mAb |
---|---|
Catalog No. | A4140 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0905 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AT1R/AGTR1 (P30556). |
---|---|
Sequence | MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYL |
Gene ID | |
Swiss Prot | |
Synonyms | AT1; AG2S; AT1B; AT1R; ATR1; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B |
Calculated MW | 41kDa |
Observed MW | 50kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549 |
Cellular location | plasma membrane, Cell membrane |
Customer validation | WB(Rattus norvegicus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4140? Please let us know so that we can cite the reference in this datasheet.