Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATF6 Rabbit pAb |
---|---|
Catalog No. | A0202 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-300 of human ATF6 (NP_031374.2). |
---|---|
Sequence | PKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV |
Gene ID | |
Swiss Prot | |
Synonyms | ACHM7; ATF6A; ATF6 |
Calculated MW | 75kDa |
Observed MW | 90-100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat lung |
Cellular location | Endoplasmic reticulum membrane, Nucleus, Single-pass type II membrane protein. |
Customer validation | WB(Sus scrofa, Rattus norvegicus, Mus musculus, Homo sapiens, Trachemys scripta elegans, Chlorocebus aethiops, Bos taurus, Gallus gallus, Brachyura, Anatinae) IF(Homo sapiens) IF(Mus musculus, Homo sapiens) IHC(Homo sapiens, Mus musculus) WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0202? Please let us know so that we can cite the reference in this datasheet.