제품 > 항체 > 다중클론항체(pAb)

ATG14 Rabbit pAb (A7526)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ATG14 Rabbit pAb (A7526) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from Neuro-2a cells, using ATG14 Rabbit pAb (A7526) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - ATG14 Rabbit pAb (A7526)

Immunofluorescence analysis of U2OS cells using ATG14 Rabbit pAb (A7526) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	ATG14 Rabbit pAb
Catalog No.	A7526
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables GTPase binding activity. Involved in several processes, including macroautophagy; regulation of phosphorylation; and response to mitochondrial depolarisation. Acts upstream of or within endosome to lysosome transport. Located in autophagosome and phagophore assembly site membrane. Is extrinsic component of omegasome membrane and extrinsic component of phagophore assembly site membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 340-440 of human ATG14 (NP_055739.2).
Sequence	SKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPS
Gene ID
Swiss Prot
Synonyms	ATG14L; BARKOR; KIAA0831; ATG14
Calculated MW	55kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, SH-SY5Y, Neuro-2a
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Peripheral membrane protein, Preautophagosomal structure membrane, autophagosome membrane.
Customer validation	IP(Nicotiana tabacum) WB(Homo sapiens, Mus musculus) IF(Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus)