Review (2)Publication (3) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ATG4B Rabbit mAb |
---|---|
Catalog No. | A5059 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1264 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG4B (Q9Y4P1). |
---|---|
Sequence | DRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH |
Gene ID | |
Swiss Prot | |
Synonyms | APG4B; AUTL1; HsAPG4B; ATG4B |
Calculated MW | 44kDa |
Observed MW | 48kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Hep G2, RD, Jurkat, Mouse testis, Mouse brain, Rat lung, Rat brain |
Cellular location | Cytoplasm |
Customer validation | (293T、Hela 、A549、HepG2 、 PC-3、MLOT-4 、MCF-7, 293T, Hela, A549, HepG2, PC-3, HL-60, RPMI-8226, MOLT-4, MCF-7) WB(Rattus norvegicus, Danio rerio) IF(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5059? Please let us know so that we can cite the reference in this datasheet.