Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | ATP2B4 Rabbit pAb |
---|---|
Catalog No. | A10105 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3). |
---|---|
Sequence | ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV |
Gene ID | |
Swiss Prot | |
Synonyms | MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x |
Calculated MW | 138kDa |
Observed MW | 138kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain |
Cellular location | Cell membrane, Cell projection, Multi-pass membrane protein, cilium, flagellum membrane |
* For research use only. Not for therapeutic or diagnostic purposes.