제품 > 항체 > 다중클론항체(pAb)

ATP5O Rabbit pAb (A8103)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ATP5O Rabbit pAb (A8103) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ATP5O Rabbit pAb (A8103)

Immunohistochemistry analysis of paraffin-embedded Rat stomach using ATP5O Rabbit pAb (A8103) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using ATP5O Rabbit pAb (A8103) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ATP5O Rabbit pAb (A8103)

Immunofluorescence analysis of U2OS cells using ATP5O Rabbit pAb (A8103) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	ATP5O Rabbit pAb
Catalog No.	A8103
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-213 of human ATP5O (NP_001688.1).
Sequence	FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Gene ID
Swiss Prot
Synonyms	ATPO; OSCP; ATP5O; HMC08D05
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	NCI-H460, A-549, U-251MG, SKOV3, MCF-7, Mouse liver, Mouse lung, Mouse heart, Rat heart
Cellular location	Mitochondrion, Mitochondrion inner membrane