Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ATP6V1C1 Rabbit pAb |
---|---|
Catalog No. | A18253 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). |
---|---|
Sequence | LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK |
Gene ID | |
Swiss Prot | |
Synonyms | VATC; Vma5; ATP6C; ATP6D; ATP6V1C1 |
Calculated MW | 44kDa |
Observed MW | 43kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, 293T, Mouse kidney |
Cellular location | cytosol, extracellular exosome, extrinsic component of synaptic vesicle membrane, plasma membrane |
Customer validation | WB(Homo sapiens) Co-IP(Drosophila melanogaster) WB(Drosophila melanogaster) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18253? Please let us know so that we can cite the reference in this datasheet.