제품 > 항체 > 다중클론항체(pAb)

ATRNL1 Rabbit pAb (A14868)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from mouse liver, using ATRNL1 Rabbit pAb (A14868) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ATRNL1 Rabbit pAb
Catalog No.	A14868
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable carbohydrate binding activity. Predicted to be involved in several processes, including animal organ morphogenesis; cell migration; and substrate adhesion-dependent cell spreading. Predicted to act upstream of or within G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be active in basement membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 53-160 of human ATRNL1 (NP_001263211.1).
Sequence	LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
Gene ID
Swiss Prot
Synonyms	ALP; bA338L11.1; bA454H24.1; ATRNL1
Calculated MW	153kDa
Observed MW	153kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens, Mus musculus)