제품 > 항체 > 단일클론항체(mAb)

ATR Rabbit mAb (A21253)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using ATR Rabbit mAb (A21253) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	ATR Rabbit mAb
Catalog No.	A21253
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51749

Background

The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATR (NP_001175.2).
Sequence	KAYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNK
Gene ID
Swiss Prot
Synonyms	FRP1; MEC1; SCKL; FCTCS; SCKL1; ATR
Calculated MW	301kDa
Observed MW	301kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-431, Mouse testis
Cellular location	Chromosome, Nucleus, PML body.
Customer validation	IF(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) WB(Homo sapiens)