제품 > 항체 > 단일클론항체(mAb)

Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829)

Confocal imaging of Hep G2 cells using Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of Daudi cells using Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb (A24829, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1 Rabbit mAb
Catalog No.	A24829
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64127

Background

This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 777-976 of human Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1(NP_001071.1).
Sequence	LGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Gene ID
Swiss Prot
Synonyms	SSDH; SSADH; Aldehyde dehydrogenase 5-A1/SSADH/ALDH5A1?
Calculated MW	57kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:200 - 1:2000 IF/ICC 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Caco-2, Mouse liver
Cellular location	Mitochondrion.