Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BLK Rabbit pAb |
---|---|
Catalog No. | A7427 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human BLK (NP_001706.2). |
---|---|
Sequence | MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS |
Gene ID | |
Swiss Prot | |
Synonyms | MODY11; BLK |
Calculated MW | 58kDa |
Observed MW | 58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y, Mouse spleen, Mouse brain, Rat spleen, Rat brain, Mouse thymus |
Cellular location | Cell membrane, Lipid-anchor |
Customer validation | WB(Homo sapiens, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7427? Please let us know so that we can cite the reference in this datasheet.