Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BMP6 Rabbit mAb |
---|---|
Catalog No. | A4538 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1025 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BMP6 (NP_001709.1). |
---|---|
Sequence | DGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLN |
Gene ID | |
Swiss Prot | |
Synonyms | IO; VGR; VGR1; BMP6 |
Calculated MW | 57kDa |
Observed MW | 42kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-2 OS, 293T, A549, Mouse lung, Mouse kidney, Mouse heart, Rat lung, Rat brain |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Homo sapiens) IF(Mus musculus) RNA-Seq(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4538? Please let us know so that we can cite the reference in this datasheet.