제품 > 항체 > 단일클론항체(mAb)

BMP6 Rabbit mAb (A4538)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using BMP6 Rabbit mAb (A4538) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - BMP6 Rabbit mAb (A4538)

Immunofluorescence analysis of NIH-3T3 cells using BMP6 Rabbit mAb (A4538) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using BMP6 Rabbit mAb (A4538) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	BMP6 Rabbit mAb
Catalog No.	A4538
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1025

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BMP6 (NP_001709.1).
Sequence	DGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLN
Gene ID
Swiss Prot
Synonyms	IO; VGR; VGR1; BMP6
Calculated MW	57kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-2 OS, 293T, A549, Mouse lung, Mouse kidney, Mouse heart, Rat lung, Rat brain
Cellular location	Secreted.
Customer validation	WB(Mus musculus, Homo sapiens) IF(Mus musculus) RNA-Seq(Homo sapiens) WB(Homo sapiens)