제품 > 항체 > 다중클론항체(pAb)

Bcdin3d Rabbit pAb (A20720)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of MCF7 cells, using Bcdin3d antibody (A20720) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Bcdin3d Rabbit pAb (A20720)

Immunofluorescence analysis of NIH/3T3 cells using Bcdin3d Rabbit pAb (A20720) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Bcdin3d Rabbit pAb
Catalog No.	A20720
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable O-methyltransferase activity and tRNA methyltransferase activity. Predicted to be involved in miRNA 2'-O-methylation; negative regulation of pre-miRNA processing; and tRNA methylation. Predicted to act upstream of or within methylation. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human BCDIN3D (BCDIN3 domain containing RNA methyltransferase).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 65-197 of mouse Bcdin3d (NP_083512.2).
Sequence	EKRPILGLDVGCNSGDLSVALYKHFLSPRDGETCSGASRELRILCCDIDPVLVERAERDCPFPEALTFITLDIMDQESRKVPLSSFLSQFGRSVFDMVFCMSVTMWIHLNHGDRGLCEFLAHVSSLCSYLLVE
Gene ID
Swiss Prot
Synonyms	4930556P03Rik
Calculated MW	32kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7
Cellular location	cytoplasm, cytosol, nucleoplasm