제품 > 항체 > 단일클론항체(mAb)

Biotin Rabbit anti-Human CD7 mAb (A27378)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 A549 cells (negative control, left) and Human PBMC (Lymphocytes, right) were surface-stained with Biotin Rabbit anti-Human CD7 mAb (A27378, 5 μl/Test, orange line) or Biotin Rabbit IgG isotype control (A25626, 5 μl/Test, blue line), followed by ABflo® 488 Streptavidin staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC (Lymphocytes, right) were surface-stained with Biotin Rabbit IgG isotype control (A25626, 5 μl/Test, left) or Biotin Rabbit anti-Human CD7 mAb (A27378, 5 μl/Test, right), followed by ABflo® 488 Streptavidin staining.

Overview

Product name	Biotin Rabbit anti-Human CD7 mAb
Catalog No.	A27378
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54668-Biotin

Background

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1).
Sequence	AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Gene ID
Swiss Prot
Synonyms	GP40; TP41; Tp40; LEU-9
Calculated MW	25kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Plasma membrane, Membrane, Single-pass type I membrane protein.