Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Other (Wide Range Predicted)
Western blot analysis of extracts of 293T cells and 293T transfected with CAS9 protein, using CAS9 Rabbit pAb (A14997) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.
| Product name | CAS9 Rabbit pAb |
|---|---|
| Catalog No. | A14997 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 450-730 of streptococcus pyogenes m1 gas CAS9 (NP_269215.1). |
|---|---|
| Sequence | YYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CAS9 |
| Calculated MW | |
| Observed MW | 160kDa |
| Reactivity | Human, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | 293T |
| Cellular location | |
| Customer validation | WB(Mus musculus, Bos taurus, Homo sapiens) Co-IP(Homo sapiens) FC(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14997? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1718073737 "ABclonal:Western blot - CAS9 Rabbit pAb (A14997)")
