제품 > 항체 > 다중클론항체(pAb)

CD225/IFITM1 Rabbit pAb (A4228)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from K-562 cells, using CD225/IFITM1 Rabbit pAb (A4228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CD225/IFITM1 Rabbit pAb (A4228)

Immunohistochemistry analysis of paraffin-embedded mouse liver using CD225/IFITM1 Rabbit pAb (A4228) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse spleen using CD225/IFITM1 Rabbit pAb (A4228) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using CD225/IFITM1 Rabbit pAb (A4228) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	CD225/IFITM1 Rabbit pAb
Catalog No.	A4228
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-125 of human CD225/IFITM1 (NP_003632.3).
Sequence	CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Gene ID
Swiss Prot
Synonyms	9-27; CD225; IFI17; LEU13; DSPA2a; CD225/IFITM1
Calculated MW	14kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	K-562
Cellular location	Cell membrane, Single-pass membrane protein
Customer validation	WB(Homo sapiens)