제품 > 항체 > 단일클론항체(mAb)

CD239/BCAM Rabbit mAb (A23695)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using CD239/BCAM Rabbit mAb (A23695) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Flow CytoMetry - CD239/BCAM Rabbit mAb (A23695)

Flow cytometry: 1X10^6 SH-SY5Y cells (Low Expression, left) and SK-BR-3 cells (right) were surface-stained with CD239/BCAM Rabbit mAb(A23695, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 SK-BR-3 cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD239/BCAM Rabbit mAb(A23695, 2 μg/mL, right).

Overview

Product name	CD239/BCAM Rabbit mAb
Catalog No.	A23695
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61168

Background

This gene encodes Lutheran blood group glycoprotein, a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five extracellular immunoglobulin domains, a single transmembrane domain, and a short C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Polymorphisms in this gene define some of the antigens in the Lutheran system and also the Auberger system. Inactivating variants of this gene result in the recessive Lutheran null phenotype, Lu(a-b-), of the Lutheran blood group. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 32-547 of human CD239/BCAM（NP_005572.2）
Sequence	EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA
Gene ID
Swiss Prot
Synonyms	AU; LU; CD239; MSK19
Calculated MW	67kDa
Observed MW	85kDa/78kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	T-47D, SK-BR-3
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD239/BCAM Rabbit mAb images

Western blot - CD239/BCAM Rabbit mAb (A23695)

Flow CytoMetry - CD239/BCAM Rabbit mAb (A23695)

Flow cytometry:1X10^6 SK-BR-3 cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD239/BCAM Rabbit mAb(A23695, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.