제품 > 항체 > 단일클론항체(mAb)

CD31/PECAM1 Mouse mAb (A27114)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CD31/PECAM1 Mouse mAb (A27114) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): SK-BR-3
Exposure time: 90s.

ABclonal:Immunohistochemistry - CD31/PECAM1 Mouse mAb (A27114)

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using CD31/PECAM1 Mouse mAb (A27114) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CD31/PECAM1 Mouse mAb (A27114) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using CD31/PECAM1 Mouse mAb (A27114) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD31/PECAM1 Mouse mAb (A27114)

Confocal imaging of paraffin-embedded Human placenta tissue using CD31/PECAM1 Mouse mAb (A27114, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	CD31/PECAM1 Mouse mAb
Catalog No.	A27114
Host species	Mouse
Purification method	Affinity purification
Isotype	IgG
CloneNo.	AMC50033

Background

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence	AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID
Swiss Prot
Synonyms	CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM
Calculated MW	83kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	THP-1
Cellular location	Cell junction, Cell membrane, Single-pass type I membrane protein.