Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Human kidney using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human thyroid using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded human placenta using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
| Product name | CD31/PECAM1 Rabbit mAb |
|---|---|
| Catalog No. | A19014 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC50362 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). |
|---|---|
| Sequence | AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1 |
| Calculated MW | 83kDa |
| Observed MW | 135kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | THP-1 cells, Mouse lung, Rat lung |
| Cellular location | Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein. |
| Customer validation | IHC(Homo sapiens, Rattus norvegicus, Mus musculus) IF(Mus musculus, Homo sapiens, Rattus norvegicus) WB(Mus musculus, Rattus norvegicus, Homo sapiens) WB(Homo sapiens,Mus musculus) IF(Rattus norvegicus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19014? Please let us know so that we can cite the reference in this datasheet.
