Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates using Histone H2AX Rabbit pAb (A11361) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human stomach using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2 OS cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.
| Product name | Histone H2AX Rabbit pAb |
|---|---|
| Catalog No. | A11361 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-143 of human Histone H2AX (NP_002096.1). |
|---|---|
| Sequence | VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H2A.X; H2A/X; H2AFX; Histone H2AX |
| Calculated MW | 15kDa |
| Observed MW | 16kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, MCF-7, NIH/3T3, Raji, Mouse testis, Mouse thymus, Rat thymus |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | IHC(Homo sapiens) WB(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11361? Please let us know so that we can cite the reference in this datasheet.
